PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005966P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 340aa    MW: 38173.4 Da    PI: 7.4446
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005966P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.31.4e-40103180178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +CqvegC++ l +ak+yhrrh+vCe+hskap+v+v gl qrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  MELO3C005966P1 103 RCQVEGCHVALVNAKDYHRRHRVCEMHSKAPKVVVLGLDQRFCQQCSRFHVISEFDDSKRSCRRRLAGHNERRRKSSH 180
                     6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.1E-34100165IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.453101178IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.05E-38102182IPR004333Transcription factor, SBP-box
PfamPF031107.6E-32104177IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010358Biological Processleaf shaping
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MEMEICGNLM GHSNPNAATN LSWPNNTITN NNNNSNIIWE LNSQQPHFLY ASGEHNPTTH  60
FHPDPHLMCL NLGKRHYFED SNAPSLILGK RAKSPFYATT VPRCQVEGCH VALVNAKDYH  120
RRHRVCEMHS KAPKVVVLGL DQRFCQQCSR FHVISEFDDS KRSCRRRLAG HNERRRKSSH  180
ESARNCTQAE NKSMTNGIAY VPSPTGRALS LLSSKNESWA NSSELSQRSS AALRELIAEN  240
RAAILARQLI LDRDWHSNHG ATDDFGGGGV GFQQQGLYCE QQHSWERMNE NGGSHVTLDL  300
MQAPSSAFGL LSVRGKSKEE DEECCELWNS FNDHDPHVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-301041771184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437791.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X1
SwissprotQ7XT422e-56SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLA0A0A0L8C00.0A0A0A0L8C0_CUCSA; Uncharacterized protein
STRINGVIT_15s0021g02290.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.41e-40squamosa promoter binding protein-like 10